PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn124881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 160aa    MW: 17777.2 Da    PI: 9.1826
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn124881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-394299259
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrknk
  Achn124881 42 PDKIIPCPRCKSMDTKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKNK 99
                68999****************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-294099IPR003851Zinc finger, Dof-type
PfamPF027012.5E-324499IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.60246100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MADVHEAQGI KLFGATIAVQ LRQAKDEPII TKSDQTTDQK RPDKIIPCPR CKSMDTKFCY  60
FNNYNVNQPR HFCKGCQRYW TAGGALRNVP VGAGRRKNKP PCPEFVAGAS FPESCFFDDG  120
VQQFDFDGVL VEEWRRAAGG FHRVFPAKRL RSGSGGQSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153884e-50AC215388.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0122E16, complete sequence.
GenBankHG9755144e-50HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212176.19e-69hypothetical protein PRUPE_ppa012605mg
SwissprotO229676e-59CDF4_ARATH; Cyclic dof factor 4
TrEMBLF6M8H32e-71F6M8H3_9ASTR; Dof-domain transcription factor protein
STRINGVIT_10s0003g01260.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-56Dof family protein